IDH1 antibody (70R-2452)

Rabbit polyclonal IDH1 antibody

Synonyms Polyclonal IDH1 antibody, Anti-IDH1 antibody, Nadp+ Soluble antibody, IDP antibody, PICD antibody, IDH1, IDH-1 antibody, IDH 1 antibody, Isocitrate Dehydrogenase 1 antibody, IDH antibody, IDH 1, IDH-1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG
Assay Information IDH1 Blocking Peptide, catalog no. 33R-6238, is also available for use as a blocking control in assays to test for specificity of this IDH1 antibody

Images

Western Blot analysis using IDH1 antibody (70R-2452)

IDH1 antibody (70R-2452) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IDH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IDH1 antibody (70R-2452) | IDH1 antibody (70R-2452) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors