IDI1 antibody (70R-3705)

Rabbit polyclonal IDI1 antibody raised against the middle region of IDI1

Synonyms Polyclonal IDI1 antibody, Anti-IDI1 antibody, IDI 1 antibody, IPPI1 antibody, IPP1 antibody, IDI 1, Isopentenyl-Diphosphate Delta Isomerase 1 antibody, IDI-1 antibody, IDI-1, IDI1
Specificity IDI1 antibody was raised against the middle region of IDI1
Cross Reactivity Human,Mouse
Applications WB
Immunogen IDI1 antibody was raised using the middle region of IDI1 corresponding to a region with amino acids PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA
Assay Information IDI1 Blocking Peptide, catalog no. 33R-7208, is also available for use as a blocking control in assays to test for specificity of this IDI1 antibody

Images

Western Blot analysis using IDI1 antibody (70R-3705)

IDI1 antibody (70R-3705) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IDI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IDI1 is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IDI1 antibody (70R-3705) | IDI1 antibody (70R-3705) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors