IFI44 antibody (70R-3661)

Rabbit polyclonal IFI44 antibody raised against the middle region of IFI44

Synonyms Polyclonal IFI44 antibody, Anti-IFI44 antibody, MTAP44 antibody, IFI 44, p44 antibody, Interferon-Induced Protein 44 antibody, IFI-44 antibody, IFI44, IFI-44, IFI 44 antibody
Specificity IFI44 antibody was raised against the middle region of IFI44
Cross Reactivity Human
Applications WB
Immunogen IFI44 antibody was raised using the middle region of IFI44 corresponding to a region with amino acids LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS
Assay Information IFI44 Blocking Peptide, catalog no. 33R-5042, is also available for use as a blocking control in assays to test for specificity of this IFI44 antibody


Western Blot analysis using IFI44 antibody (70R-3661)

IFI44 antibody (70R-3661) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFI44 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein aggregates to form microtubular structures.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IFI44 antibody (70R-3661) | IFI44 antibody (70R-3661) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors