IFN Gamma R2 antibody (70R-6702)

Rabbit polyclonal IFN Gamma R2 antibody

Synonyms Polyclonal IFN Gamma R2 antibody, Anti-IFN Gamma R2 antibody, IFNGR2 antibody, Interferon Gamma Receptor 2 antibody, Interferon Gamma Transducer 1 antibody, IFNGT1 antibody, IFGR2 antibody, AF-1 antibody
Cross Reactivity Human
Applications WB
Immunogen IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL
Assay Information IFN Gamma R2 Blocking Peptide, catalog no. 33R-9941, is also available for use as a blocking control in assays to test for specificity of this IFN Gamma R2 antibody

Images

Western Blot analysis using IFN Gamma R2 antibody (70R-6702)

IFN Gamma R2 antibody (70R-6702) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFNGR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IFN Gamma R2 antibody (70R-6702) | IFN Gamma R2 antibody (70R-6702) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors