IFRD1 antibody (70R-3682)

Rabbit polyclonal IFRD1 antibody raised against the middle region of IFRD1

Synonyms Polyclonal IFRD1 antibody, Anti-IFRD1 antibody, TIS7 antibody, Interferon-Related Developmental Regulator 1 antibody, PC4 antibody
Specificity IFRD1 antibody was raised against the middle region of IFRD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IFRD1 antibody was raised using the middle region of IFRD1 corresponding to a region with amino acids LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF
Assay Information IFRD1 Blocking Peptide, catalog no. 33R-4784, is also available for use as a blocking control in assays to test for specificity of this IFRD1 antibody

Images

Western Blot analysis using IFRD1 antibody (70R-3682)

IFRD1 antibody (70R-3682) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFRD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IFRD1 antibody (70R-3682) | IFRD1 antibody (70R-3682) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors