IFT140 antibody (70R-6046)

Rabbit polyclonal IFT140 antibody

Synonyms Polyclonal IFT140 antibody, Anti-IFT140 antibody, c305C8.4 antibody, c380F5.1 antibody, WDTC2 antibody, KIAA0590 antibody, DKFZp564L232 antibody, FLJ10306 antibody, FLJ30571 antibody, Intraflagellar Transport 140 Homolog antibody, gs114 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen IFT140 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF
Assay Information IFT140 Blocking Peptide, catalog no. 33R-9681, is also available for use as a blocking control in assays to test for specificity of this IFT140 antibody

Images

Western Blot analysis using IFT140 antibody (70R-6046)

IFT140 antibody (70R-6046) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 165 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFT140 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFT140 contains 9 TPR repeats and 5 WD repeats. The function of the IFT140 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IFT140 antibody (70R-6046) | IFT140 antibody (70R-6046) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors