IFT74 Blocking Peptide (33R-10429)

A synthetic peptide for use as a blocking control in assays to test for specificity of IFT74 antibody, catalog no. 70R-10410

Synonyms IFT74 control peptide, IFT74 antibody Blocking Peptide, Anti-IFT74 Blocking Peptide, intraflagellar transport 74 homolog, Chlamydomonas Blocking Peptide, CCDC2 Blocking Peptide, CMG-1 Blocking Peptide, CMG1 Blocking Peptide, FLJ22621 Blocking Peptide, MGC111562 Blocking Peptide, IFT74, IFT-74, IFT 74, IFT-74 Blocking Peptide, IFT 74 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues WQHLEQNNFAMKEFIATKSQESDYQPIKKNVTKQIAEYNKTIVDALHSTS
Molecular Weight 48 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors