IGF2BP2 antibody (70R-4909)

Rabbit polyclonal IGF2BP2 antibody raised against the middle region of IGF2BP2

Synonyms Polyclonal IGF2BP2 antibody, Anti-IGF2BP2 antibody, IGF 2, IGF 2 antibody, VICKZ2 antibody, p62 antibody, IGF2, IMP2 antibody, IGF-2, IMP-2 antibody, Insulin-Like Growth Factor 2 mRNA Binding Protein 2 antibody, IGF-2 antibody
Specificity IGF2BP2 antibody was raised against the middle region of IGF2BP2
Cross Reactivity Human
Applications WB
Immunogen IGF2BP2 antibody was raised using the middle region of IGF2BP2 corresponding to a region with amino acids QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS
Assay Information IGF2BP2 Blocking Peptide, catalog no. 33R-7470, is also available for use as a blocking control in assays to test for specificity of this IGF2BP2 antibody

Images

Western Blot analysis using IGF2BP2 antibody (70R-4909)

IGF2BP2 antibody (70R-4909) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGF2BP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IGF2BP2 binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. IGF2BP2 may regulate translation of target mRNAs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IGF2BP2 antibody (70R-4909) | IGF2BP2 antibody (70R-4909) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors