IGFALS antibody (70R-6058)

Rabbit polyclonal IGFALS antibody raised against the middle region of IGFALS

Synonyms Polyclonal IGFALS antibody, Anti-IGFALS antibody, ALS antibody, Insulin-Like Growth Factor Binding Protein Acid Labile Subunit antibody
Specificity IGFALS antibody was raised against the middle region of IGFALS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG
Assay Information IGFALS Blocking Peptide, catalog no. 33R-7116, is also available for use as a blocking control in assays to test for specificity of this IGFALS antibody


Western Blot analysis using IGFALS antibody (70R-6058)

IGFALS antibody (70R-6058) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGFALS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IGFALS is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in IGFALS are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IGFALS antibody (70R-6058) | IGFALS antibody (70R-6058) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors