IGFBP2 antibody (70R-5304)

Rabbit polyclonal IGFBP2 antibody raised against the middle region of IGFBP2

Synonyms Polyclonal IGFBP2 antibody, Anti-IGFBP2 antibody, IGFBP-2, IGFBP-2 antibody, IGFBP 2, IGFBP 2 antibody, IBP2 antibody, IGF-BP53 antibody, Insulin-Like Growth Factor Binding Protein 2 36Kda antibody, IGFBP2
Specificity IGFBP2 antibody was raised against the middle region of IGFBP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ
Assay Information IGFBP2 Blocking Peptide, catalog no. 33R-4590, is also available for use as a blocking control in assays to test for specificity of this IGFBP2 antibody

Images

Western Blot analysis using IGFBP2 antibody (70R-5304)

IGFBP2 antibody (70R-5304) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGFBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IGFBP2 antibody (70R-5304) | IGFBP2 antibody (70R-5304) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors