IGFBP4 antibody (70R-5309)

Rabbit polyclonal IGFBP4 antibody raised against the middle region of IGFBP4

Synonyms Polyclonal IGFBP4 antibody, Anti-IGFBP4 antibody, Insulin-Like Growth Factor Binding Protein 4 antibody, IGFBP 4, IGFBP-4 antibody, IGFBP-4, IBP4 antibody, BP-4 antibody, IGFBP4, HT29-IGFBP antibody, IGFBP 4 antibody, IGFBP-4 antibody
Specificity IGFBP4 antibody was raised against the middle region of IGFBP4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IGFBP4 antibody was raised using the middle region of IGFBP4 corresponding to a region with amino acids RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
Assay Information IGFBP4 Blocking Peptide, catalog no. 33R-7813, is also available for use as a blocking control in assays to test for specificity of this IGFBP4 antibody

Images

Immunohistochemical staining using IGFBP4 antibody (70R-5309)

IGFBP4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGFBP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IGFBP4 is a member of the insulin-like growth factor binding protein (IGFBP) family. IGFBP4 is a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using IGFBP4 antibody (70R-5309) | IGFBP4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using IGFBP4 antibody (70R-5309) | IGFBP4 antibody (70R-5309) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors