IGSF1 antibody (70R-1671)

Rabbit polyclonal IGSF1 antibody raised against the N terminal of IGSF1

Synonyms Polyclonal IGSF1 antibody, Anti-IGSF1 antibody, IGDC1 antibody, PGSF2 antibody, IGSF 1 antibody, Immunoglobulin Superfamily Member 1 antibody, MGC75490 antibody, IGCD1 antibody, IGSF-1 antibody, IGSF-1, KIAA0364 antibody, IGSF1, IGSF 1, INHBP antibody
Specificity IGSF1 antibody was raised against the N terminal of IGSF1
Cross Reactivity Human
Applications IHC, WB
Immunogen IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR
Assay Information IGSF1 Blocking Peptide, catalog no. 33R-4821, is also available for use as a blocking control in assays to test for specificity of this IGSF1 antibody


Immunohistochemical staining using IGSF1 antibody (70R-1671)

IGSF1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IGSF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using IGSF1 antibody (70R-1671) | IGSF1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using IGSF1 antibody (70R-1671) | IGSF1 antibody (70R-1671) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors