IGSF11 antibody (70R-6403)

Rabbit polyclonal IGSF11 antibody raised against the middle region of IGSF11

Synonyms Polyclonal IGSF11 antibody, Anti-IGSF11 antibody, IGSF 11 antibody, IGSF-11, Immunoglobulin Superfamily Member 11 antibody, IGSF11, VSIG3 antibody, BT-IgSF antibody, Igsf13 antibody, CXADRL1 antibody, IGSF 11, MGC35227 antibody, IGSF-11 antibody
Specificity IGSF11 antibody was raised against the middle region of IGSF11
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IGSF11 antibody was raised using the middle region of IGSF11 corresponding to a region with amino acids EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL
Assay Information IGSF11 Blocking Peptide, catalog no. 33R-2510, is also available for use as a blocking control in assays to test for specificity of this IGSF11 antibody

Images

Western Blot analysis using IGSF11 antibody (70R-6403)

IGSF11 antibody (70R-6403) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGSF11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IGSF11 functions as a cell adhesion molecule through homophilic interaction. IGSF11 stimulates cell growth.IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor and endothelial cell-selective adhesion molecule.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IGSF11 antibody (70R-6403) | IGSF11 antibody (70R-6403) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors