IGSF9 antibody (70R-7213)

Rabbit polyclonal IGSF9 antibody raised against the N terminal of IGSF9

Synonyms Polyclonal IGSF9 antibody, Anti-IGSF9 antibody, KIAA1355 antibody, IGSF9A antibody, FP18798 antibody, IGSF 9, IGSF-9 antibody, IGSF-9, Immunoglobulin Superfamily Member 9 antibody, Nrt1 antibody, IGSF 9 antibody, IGSF9
Specificity IGSF9 antibody was raised against the N terminal of IGSF9
Cross Reactivity Human
Applications WB
Immunogen IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA
Assay Information IGSF9 Blocking Peptide, catalog no. 33R-8693, is also available for use as a blocking control in assays to test for specificity of this IGSF9 antibody

Images

Western Blot analysis using IGSF9 antibody (70R-7213)

IGSF9 antibody (70R-7213) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 125 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGSF9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IGSF9 antibody (70R-7213) | IGSF9 antibody (70R-7213) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors