IL1 alpha antibody (70R-5693)

Rabbit polyclonal IL1 alpha antibody raised against the N terminal of IL1A

Synonyms Polyclonal IL1 alpha antibody, Anti-IL1 alpha antibody, IL1-ALPHA antibody, Interleukin 1 Alpha antibody, IL1F1 antibody, IL-1A antibody, IL1A antibody, IL1 antibody
Specificity IL1 alpha antibody was raised against the N terminal of IL1A
Cross Reactivity Human
Applications WB
Immunogen IL1 alpha antibody was raised using the N terminal of IL1A corresponding to a region with amino acids VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS
Assay Information IL1 alpha Blocking Peptide, catalog no. 33R-9834, is also available for use as a blocking control in assays to test for specificity of this IL1 alpha antibody


Western Blot analysis using IL1 alpha antibody (70R-5693)

IL1 alpha antibody (70R-5693) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The IL1A protein is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IL1 alpha antibody (70R-5693) | IL1 alpha antibody (70R-5693) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors