IL1 beta antibody (70R-5695)

Rabbit polyclonal IL1 beta antibody raised against the N terminal of IL1B

Synonyms Polyclonal IL1 beta antibody, Anti-IL1 beta antibody, IL1-BETA antibody, IL beta 1, IL-1 antibody, IL1B antibody, IL beta-1, IL1 beta, Interleukin 1 Beta antibody, IL1F2 antibody, IL beta-1 antibody, IL beta 1 antibody
Specificity IL1 beta antibody was raised against the N terminal of IL1B
Cross Reactivity Human
Applications WB
Immunogen IL1 beta antibody was raised using the N terminal of IL1B corresponding to a region with amino acids DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE
Assay Information IL1 beta Blocking Peptide, catalog no. 33R-2037, is also available for use as a blocking control in assays to test for specificity of this IL1 beta antibody

Images

Western Blot analysis using IL1 beta antibody (70R-5695)

IL1 beta antibody (70R-5695) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL1 beta antibody (70R-5695) | IL1 beta antibody (70R-5695) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors