IL11R alpha antibody (70R-7222)

Rabbit polyclonal IL11R alpha antibody raised against the middle region of IL11RA

Synonyms Polyclonal IL11R alpha antibody, Anti-IL11R alpha antibody, IL 11 antibody, MGC2146 antibody, IL11, IL 11, Interleukin 11 Receptor Alpha antibody, IL11RA antibody, IL-11 antibody, IL-11
Specificity IL11R alpha antibody was raised against the middle region of IL11RA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IL11R alpha antibody was raised using the middle region of IL11RA corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA
Assay Information IL11R alpha Blocking Peptide, catalog no. 33R-2968, is also available for use as a blocking control in assays to test for specificity of this IL11R alpha antibody

Images

Western Blot analysis using IL11R alpha antibody (70R-7222)

IL11R alpha antibody (70R-7222) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL11RA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. IL11RA is the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL11R alpha antibody (70R-7222) | IL11R alpha antibody (70R-7222) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors