IL11R alpha antibody (70R-7223)

Rabbit polyclonal IL11R alpha antibody raised against the N terminal of IL11RA

Synonyms Polyclonal IL11R alpha antibody, Anti-IL11R alpha antibody, MGC2146 antibody, IL11, IL-11 antibody, IL 11, IL11RA antibody, IL 11 antibody, IL-11, Interleukin 11 Receptor Alpha antibody
Specificity IL11R alpha antibody was raised against the N terminal of IL11RA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IL11R alpha antibody was raised using the N terminal of IL11RA corresponding to a region with amino acids QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGAD
Assay Information IL11R alpha Blocking Peptide, catalog no. 33R-7626, is also available for use as a blocking control in assays to test for specificity of this IL11R alpha antibody

Images

Western Blot analysis using IL11R alpha antibody (70R-7223)

IL11R alpha antibody (70R-7223) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL11RA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. IL11RA is the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL11R alpha antibody (70R-7223) | IL11R alpha antibody (70R-7223) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors