IL15 antibody (70R-5910)

Rabbit polyclonal IL15 antibody raised against the N terminal of IL15

Synonyms Polyclonal IL15 antibody, Anti-IL15 antibody, IL-15, IL 15, IL-15 antibody, IL 15 antibody, MGC9721 antibody, IL15 antibody, IL-15 antibody, Interleukin 15 antibody, IL15
Specificity IL15 antibody was raised against the N terminal of IL15
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IL15 antibody was raised using the N terminal of IL15 corresponding to a region with amino acids RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV
Assay Information IL15 Blocking Peptide, catalog no. 33R-7982, is also available for use as a blocking control in assays to test for specificity of this IL15 antibody

Images

Western Blot analysis using IL15 antibody (70R-5910)

IL15 antibody (70R-5910) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL15 is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL15 antibody (70R-5910) | IL15 antibody (70R-5910) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors