IL15 protein (His tag) (80R-3306)

Purified recombinant IL15 protein (His tag)

Synonyms Interleukin 15 protein, IL 15 protein, IL-15 protein
Species Human
Protein Type Recombinant
Applications ELISA, SDS-PAGE, WB

Images

SDS-PAGE analysis of IL15 protein (His tag) (80R-3306)

Specifications

Residues NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILA NNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Expression System E.coli
Source His-fusion expressed in cell supernatent (soluble under denaturing conditions)
Purity > 90% pure
Molecular Weight 19 kDa
Tag/Conjugate His tag
Form & Buffer Supplied in liquid form in PBS buffer

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance IL15 is a cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • SDS-PAGE analysis of IL15 protein (His tag) (80R-3306)

Availability: In stock

Price: $210.00
Size: 50 ug
OR
Shipping
View Our Distributors