IL18R1 antibody (70R-6627)

Rabbit polyclonal IL18R1 antibody raised against the N terminal of IL18R1

Synonyms Polyclonal IL18R1 antibody, Anti-IL18R1 antibody, IL18, CDw218a antibody, IL 18, IL-18, Interleukin 18 Receptor 1 antibody, IL-1Rrp antibody, IL-18 antibody, IL18R1 antibody, IL1RRP antibody, IL 18 antibody
Specificity IL18R1 antibody was raised against the N terminal of IL18R1
Cross Reactivity Human
Applications WB
Immunogen IL18R1 antibody was raised using the N terminal of IL18R1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE
Assay Information IL18R1 Blocking Peptide, catalog no. 33R-7090, is also available for use as a blocking control in assays to test for specificity of this IL18R1 antibody


Western Blot analysis using IL18R1 antibody (70R-6627)

IL18R1 antibody (70R-6627) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL18R1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IL18R1 antibody (70R-6627) | IL18R1 antibody (70R-6627) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors