IL18RAP antibody (70R-1665)

Rabbit polyclonal IL18RAP antibody raised against the N terminal of IL18RAP

Synonyms Polyclonal IL18RAP antibody, Anti-IL18RAP antibody, MGC120589 antibody, MGC120590 antibody, IL 18 antibody, IL18RAP antibody, Interleukin 18 Receptor Accessory Protein antibody, IL-18 antibody, IL-18, IL18, ACPL antibody, CDw218b antibody, IL 18
Specificity IL18RAP antibody was raised against the N terminal of IL18RAP
Cross Reactivity Human
Applications WB
Immunogen IL18RAP antibody was raised using the N terminal of IL18RAP corresponding to a region with amino acids NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC
Assay Information IL18RAP Blocking Peptide, catalog no. 33R-6858, is also available for use as a blocking control in assays to test for specificity of this IL18RAP antibody

Images

Western Blot analysis using IL18RAP antibody (70R-1665)

IL18RAP antibody (70R-1665) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IL18RAP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL18RAP is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL18RAP antibody (70R-1665) | IL18RAP antibody (70R-1665) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors