IL1a protein (His tag) (80R-3432)

Purified recombinant IL1a protein (His tag)

Synonyms Hematopoietin 1 protein, Interleukin 1 alpha protein, IL 1a protein, IL-1a protein
Species Human
Protein Type Recombinant
Applications ELISA, SDS-PAGE, WB

Images

Western blot analysis using IL1a protein (His tag) (80R-3432)

Specifications

Residues Amino acid sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISK TQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFT SVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Expression System E.coli
Purity > 90% pure
Molecular Weight 22 kDa
Tag/Conjugate His tag
Form & Buffer Supplied in liquid form in Tris based buffer pH 8, 50% glycerol.

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance IL1a is produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using IL1a protein (His tag) (80R-3432)

Availability: In stock

Price: $210.00
Size: 50 ug
OR
Shipping
View Our Distributors