IL1RL1 antibody (70R-7411)

Rabbit polyclonal IL1RL1 antibody raised against the N terminal of IL1RL1

Synonyms Polyclonal IL1RL1 antibody, Anti-IL1RL1 antibody, IL-1 antibody, IL-1, T1 antibody, IL 1, ST2V antibody, IL1, Interleukin 1 Receptor-Like 1 antibody, MGC32623 antibody, FIT-1 antibody, IL 1 antibody, ST2L antibody, IL1RL1 antibody, DER4 antibody, ST2 antibody
Specificity IL1RL1 antibody was raised against the N terminal of IL1RL1
Cross Reactivity Human
Applications WB
Immunogen IL1RL1 antibody was raised using the N terminal of IL1RL1 corresponding to a region with amino acids RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC
Assay Information IL1RL1 Blocking Peptide, catalog no. 33R-8118, is also available for use as a blocking control in assays to test for specificity of this IL1RL1 antibody

Images

Western Blot analysis using IL1RL1 antibody (70R-7411)

IL1RL1 antibody (70R-7411) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL1RL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL1RL1 is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL1RL1 antibody (70R-7411) | IL1RL1 antibody (70R-7411) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors