IL22R alpha 1 antibody (70R-6529)

Rabbit polyclonal IL22R alpha 1 antibody raised against the middle region of IL22RA1

Synonyms Polyclonal IL22R alpha 1 antibody, Anti-IL22R alpha 1 antibody, Interleukin 22 Receptor Alpha 1 antibody, CRF2-9 antibody, IL22Ra, ILRa 22, ILRa-22 antibody, ILRa 22 antibody, ILRa-22, IL22R antibody, IL22RA1 antibody
Specificity IL22R alpha 1 antibody was raised against the middle region of IL22RA1
Cross Reactivity Human
Applications WB
Immunogen IL22R alpha 1 antibody was raised using the middle region of IL22RA1 corresponding to a region with amino acids DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE
Assay Information IL22R alpha 1 Blocking Peptide, catalog no. 33R-2131, is also available for use as a blocking control in assays to test for specificity of this IL22R alpha 1 antibody

Images

Western Blot analysis using IL22R alpha 1 antibody (70R-6529)

IL22R alpha 1 antibody (70R-6529) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL22RA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shared by the receptor complex for interleukin 10 (IL10). This gene and interleukin 28 receptor, alpha (IL28RA) form a cytokine receptor gene cluster in the chromosomal region 1p36.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL22R alpha 1 antibody (70R-6529) | IL22R alpha 1 antibody (70R-6529) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors