IL28R alpha antibody (70R-7458)

Rabbit polyclonal IL28R alpha antibody

Synonyms Polyclonal IL28R alpha antibody, Anti-IL28R alpha antibody, IFNLR antibody, IL28RA antibody, ILRa-28 antibody, LICR2 antibody, ILRa-28, IFNLR1 antibody, Interleukin 28 Receptor Alpha antibody, IL28Ra, il-28r1 antibody, Interferon Lambda Receptor antibody, CRF2/12 antibody, ILRa 28 antibody, ILRa 28
Cross Reactivity Human
Applications WB
Immunogen IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV
Assay Information IL28R alpha Blocking Peptide, catalog no. 33R-7511, is also available for use as a blocking control in assays to test for specificity of this IL28R alpha antibody


Western Blot analysis using IL28R alpha antibody (70R-7458)

IL28R alpha antibody (70R-7458) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL28RA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IL28R alpha antibody (70R-7458) | IL28R alpha antibody (70R-7458) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors