IL33 antibody (70R-3671)

Rabbit polyclonal IL33 antibody raised against the N terminal of IL33

Synonyms Polyclonal IL33 antibody, Anti-IL33 antibody, NFEHEV antibody, DKFZp586H0523 antibody, IL 33 antibody, RP11-575C20.2 antibody, IL-33, NF-HEV antibody, IL33, IL-33 antibody, DVS27 antibody, IL 33, C9orf26 antibody, IL-33 antibody, Interleukin 33 antibody
Specificity IL33 antibody was raised against the N terminal of IL33
Cross Reactivity Human
Applications WB
Immunogen IL33 antibody was raised using the N terminal of IL33 corresponding to a region with amino acids AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
Assay Information IL33 Blocking Peptide, catalog no. 33R-1291, is also available for use as a blocking control in assays to test for specificity of this IL33 antibody

Images

Western blot analysis using IL33 antibody (70R-3671)

Recommended IL33 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL33 induces T helper type 2-associated cytokines.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using IL33 antibody (70R-3671) | Recommended IL33 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using IL33 antibody (70R-3671) | Skin

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors