IL4 antibody (70R-6231)

Rabbit polyclonal IL4 antibody raised against the middle region of IL4

Synonyms Polyclonal IL4 antibody, Anti-IL4 antibody, Interleukin 4 antibody, MGC79402 antibody, IL4, IL-4, BSF1 antibody, IL-4 antibody, IL 4, IL 4 antibody, IL-4 antibody
Specificity IL4 antibody was raised against the middle region of IL4
Cross Reactivity Human
Applications WB
Immunogen IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC
Assay Information IL4 Blocking Peptide, catalog no. 33R-9363, is also available for use as a blocking control in assays to test for specificity of this IL4 antibody

Images

Western Blot analysis using IL4 antibody (70R-6231)

IL4 antibody (70R-6231) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL4 is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL4 antibody (70R-6231) | IL4 antibody (70R-6231) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors