IL4 antibody (70R-6232)

Rabbit polyclonal IL4 antibody raised against the middle region of IL4

Synonyms Polyclonal IL4 antibody, Anti-IL4 antibody, IL-4, IL4, IL 4 antibody, BSF1 antibody, IL-4 antibody, IL 4, Interleukin 4 antibody, IL-4 antibody, MGC79402 antibody
Specificity IL4 antibody was raised against the middle region of IL4
Cross Reactivity Human
Applications WB
Immunogen IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS
Assay Information IL4 Blocking Peptide, catalog no. 33R-5062, is also available for use as a blocking control in assays to test for specificity of this IL4 antibody

Images

Western Blot analysis using IL4 antibody (70R-6232)

IL4 antibody (70R-6232) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL4 is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL4 antibody (70R-6232) | IL4 antibody (70R-6232) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors