IL5 antibody (70R-6233)

Rabbit polyclonal IL5 antibody

Synonyms Polyclonal IL5 antibody, Anti-IL5 antibody, IL 5, EDF antibody, IL 5 antibody, IL-5 antibody, Colony-Stimulating Factor antibody, IL-5, TRF antibody, IL-5 antibody, IL5, Interleukin 5 antibody
Cross Reactivity Human
Applications WB
Immunogen IL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL
Assay Information IL5 Blocking Peptide, catalog no. 33R-4928, is also available for use as a blocking control in assays to test for specificity of this IL5 antibody

Images

Western Blot analysis using IL5 antibody (70R-6233)

IL5 antibody (70R-6233) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL5 antibody (70R-6233) | IL5 antibody (70R-6233) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors