IL8 protein (His tag) (80R-3408)

Purified recombinant IL8 protein (His tag)

Synonyms Interleukin 8 protein, IL 8 protein, 9E3 protein, C X C motif chemokine 8 protein, CEF 4 protein, Embryo fibroblast 1 protein, EMF 1 protein, Interleukin 8 protein E.coli, IL 8 protein, IL-8 protein
Species Human
Protein Type Recombinant
Applications ELISA, SDS-PAGE, WB

Images

Western blot analysis using IL8 protein (His tag) (80R-3408)

Specifications

Residues ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQL IVKALMAKAQLNSDAP
Expression System E.coli
Purity > 90% pure
Molecular Weight 16 kDa
Tag/Conjugate His tag
Form & Buffer Supplied in liquid form in PBS buffer

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance IL8 may be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using IL8 protein (His tag) (80R-3408)

Availability: In stock

Price: $210.00
Size: 50 ug
OR
Shipping
View Our Distributors