IL9 antibody (70R-6234)

Rabbit polyclonal IL9 antibody raised against the middle region of IL9

Synonyms Polyclonal IL9 antibody, Anti-IL9 antibody, T-cell growth factor p40 antibody, IL 9, IL-9 antibody, IL-9, Interleukin 9 antibody, IL-9 antibody, p40 cytokine antibody, P40 antibody, IL9, IL 9 antibody, HP40 antibody
Specificity IL9 antibody was raised against the middle region of IL9
Cross Reactivity Human
Applications WB
Immunogen IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT
Assay Information IL9 Blocking Peptide, catalog no. 33R-8718, is also available for use as a blocking control in assays to test for specificity of this IL9 antibody

Images

Western Blot analysis using IL9 antibody (70R-6234)

IL9 antibody (70R-6234) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding IL9 has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that IL9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL9 antibody (70R-6234) | IL9 antibody (70R-6234) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors