ILDR1 antibody (70R-7528)

Rabbit polyclonal ILDR1 antibody raised against the middle region of ILDR1

Synonyms Polyclonal ILDR1 antibody, Anti-ILDR1 antibody, ILDR1, Immunoglobulin-Like Domain Containing Receptor 1 antibody, ILDR 1 antibody, ILDR 1, ILDR-1 antibody, ILDR1beta antibody, ILDR-1, MGC50831 antibody, ILDR1alpha antibody
Specificity ILDR1 antibody was raised against the middle region of ILDR1
Cross Reactivity Human
Applications WB
Immunogen ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV
Assay Information ILDR1 Blocking Peptide, catalog no. 33R-8140, is also available for use as a blocking control in assays to test for specificity of this ILDR1 antibody

Images

Western Blot analysis using ILDR1 antibody (70R-7528)

ILDR1 antibody (70R-7528) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ILDR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ILDR1 is a putative membrane receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ILDR1 antibody (70R-7528) | ILDR1 antibody (70R-7528) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors