ILF3 antibody (70R-5643)

Rabbit polyclonal ILF3 antibody raised against the N terminal of ILF3

Synonyms Polyclonal ILF3 antibody, Anti-ILF3 antibody, Interleukin Enhancer Binding Factor 3 90Kda antibody, ILF-3 antibody, ILF 3, ILF-3, ILF 3 antibody, ILF3
Specificity ILF3 antibody was raised against the N terminal of ILF3
Cross Reactivity Human
Applications IHC, WB
Immunogen ILF3 antibody was raised using the N terminal of ILF3 corresponding to a region with amino acids ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR
Assay Information ILF3 Blocking Peptide, catalog no. 33R-1343, is also available for use as a blocking control in assays to test for specificity of this ILF3 antibody


Immunohistochemical staining using ILF3 antibody (70R-5643)

Paraffin Embedded Tissue: Human Liver Hepatocytes; Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ILF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ILF3 antibody (70R-5643) | Paraffin Embedded Tissue: Human Liver Hepatocytes; Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X
  • Immunohistochemical staining using ILF3 antibody (70R-5643) | Paraffin Embedded Tissue: Human Heart cell - cardiac cell of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X
  • Western blot analysis using ILF3 antibody (70R-5643) | Recommended ILF3 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using ILF3 antibody (70R-5643) | Paraffin Embedded Tissue: Human Heart Myocardial cells; Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors