IMPA1 antibody (70R-3549)

Rabbit polyclonal IMPA1 antibody raised against the middle region of IMPA1

Synonyms Polyclonal IMPA1 antibody, Anti-IMPA1 antibody, Myo-1 antibody, IMPA antibody, Inositol antibody
Specificity IMPA1 antibody was raised against the middle region of IMPA1
Cross Reactivity Human
Applications WB
Immunogen IMPA1 antibody was raised using the middle region of IMPA1 corresponding to a region with amino acids IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Assay Information IMPA1 Blocking Peptide, catalog no. 33R-4209, is also available for use as a blocking control in assays to test for specificity of this IMPA1 antibody

Images

Western Blot analysis using IMPA1 antibody (70R-3549)

IMPA1 antibody (70R-3549) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IMPA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IMPA1 is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. IMPA1 can use myo-inositol monophosphates, myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IMPA1 antibody (70R-3549) | IMPA1 antibody (70R-3549) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors