IMPAD1 antibody (70R-6370)

Rabbit polyclonal IMPAD1 antibody raised against the N terminal of IMPAD1

Synonyms Polyclonal IMPAD1 antibody, Anti-IMPAD1 antibody, IMPA3 antibody, Inositol Monophosphatase Domain Containing 1 antibody, FLJ20421 antibody
Specificity IMPAD1 antibody was raised against the N terminal of IMPAD1
Cross Reactivity Human, Rat
Applications WB
Immunogen IMPAD1 antibody was raised using the N terminal of IMPAD1 corresponding to a region with amino acids VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
Assay Information IMPAD1 Blocking Peptide, catalog no. 33R-9642, is also available for use as a blocking control in assays to test for specificity of this IMPAD1 antibody

Images

Western Blot analysis using IMPAD1 antibody (70R-6370)

IMPAD1 antibody (70R-6370) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IMPAD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of IMPAD protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IMPAD1 antibody (70R-6370) | IMPAD1 antibody (70R-6370) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors