IMPDH2 antibody (70R-2137)

Rabbit polyclonal IMPDH2 antibody

Synonyms Polyclonal IMPDH2 antibody, Anti-IMPDH2 antibody, IMPDH 2, IMPDH2, Imp antibody, IMPDH-2 antibody, IMPDH-2, IMPDH 2 antibody, IMPD2 antibody, IMPDH-II antibody, Inosine Monophosphate Dehydrogenase 2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IMPDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Assay Information IMPDH2 Blocking Peptide, catalog no. 33R-8336, is also available for use as a blocking control in assays to test for specificity of this IMPDH2 antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IMPDH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors