IMPG2 antibody (70R-7479)

Rabbit polyclonal IMPG2 antibody raised against the C terminal of IMPG2

Synonyms Polyclonal IMPG2 antibody, Anti-IMPG2 antibody, IPM200 antibody, SPACRCAN antibody, Interphotoreceptor Matrix Proteoglycan 2 antibody, IPM 200 antibody
Specificity IMPG2 antibody was raised against the C terminal of IMPG2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IMPG2 antibody was raised using the C terminal of IMPG2 corresponding to a region with amino acids VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL
Assay Information IMPG2 Blocking Peptide, catalog no. 33R-9875, is also available for use as a blocking control in assays to test for specificity of this IMPG2 antibody

Images

Western Blot analysis using IMPG2 antibody (70R-7479)

IMPG2 antibody (70R-7479) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 138 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IMPG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Interphotoreceptor matrix proteoglycan-2 (IMPG2) is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in th e fundus of the eye.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IMPG2 antibody (70R-7479) | IMPG2 antibody (70R-7479) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors