ING3 antibody (70R-2097)

Rabbit polyclonal ING3 antibody raised against the N terminal of ING3

Synonyms Polyclonal ING3 antibody, Anti-ING3 antibody, Inhibitor Of Growth Family Member 3 antibody, ING 3 antibody, FLJ20089 antibody, ING3, p47ING3 antibody, ING2 antibody, ING 3, Eaf4 antibody, ING-3, ING-3 antibody
Specificity ING3 antibody was raised against the N terminal of ING3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ING3 antibody was raised using the N terminal of ING3 corresponding to a region with amino acids MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ
Assay Information ING3 Blocking Peptide, catalog no. 33R-5862, is also available for use as a blocking control in assays to test for specificity of this ING3 antibody


Western Blot analysis using ING3 antibody (70R-2097)

ING3 antibody (70R-2097) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ING3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ING3 is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ING3 antibody (70R-2097) | ING3 antibody (70R-2097) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors