INSIG1 antibody (70R-6612)

Rabbit polyclonal INSIG1 antibody raised against the middle region of INSIG1

Synonyms Polyclonal INSIG1 antibody, Anti-INSIG1 antibody, MGC1405 antibody, INSIG1, CL-6 antibody, INSIG 1 antibody, INSIG-1 antibody, Insulin Induced Gene 1 antibody, INSIG 1, INSIG-1
Specificity INSIG1 antibody was raised against the middle region of INSIG1
Cross Reactivity Human
Applications WB
Immunogen INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids TTWLFHKTRSNYRVFLKSPIVIESSKPPILRARKILEENLTVDYDKDYLF
Assay Information INSIG1 Blocking Peptide, catalog no. 33R-9337, is also available for use as a blocking control in assays to test for specificity of this INSIG1 antibody


Western Blot analysis using INSIG1 antibody (70R-6612)

INSIG1 antibody (70R-6612) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of INSIG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using INSIG1 antibody (70R-6612) | INSIG1 antibody (70R-6612) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors