INSIG2 antibody (70R-6929)

Rabbit polyclonal INSIG2 antibody raised against the N terminal of INSIG2

Synonyms Polyclonal INSIG2 antibody, Anti-INSIG2 antibody, INSIG 2, INSIG-2 antibody, INSIG 2 antibody, MGC26273 antibody, INSIG2, Insulin Induced Gene 2 antibody, INSIG-2
Specificity INSIG2 antibody was raised against the N terminal of INSIG2
Cross Reactivity Human
Applications WB
Immunogen INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ
Assay Information INSIG2 Blocking Peptide, catalog no. 33R-5639, is also available for use as a blocking control in assays to test for specificity of this INSIG2 antibody

Images

Western Blot analysis using INSIG2 antibody (70R-6929)

INSIG2 antibody (70R-6929) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of INSIG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance INSIG2 is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using INSIG2 antibody (70R-6929) | INSIG2 antibody (70R-6929) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors