INSL5 antibody (70R-3660)

Rabbit polyclonal INSL5 antibody raised against the middle region of INSL5

Synonyms Polyclonal INSL5 antibody, Anti-INSL5 antibody, MGC126697 antibody, INSL 5 antibody, UNQ156 antibody, INSL5, Insulin-Like 5 antibody, MGC126695 antibody, PRO182 antibody, INSL 5, INSL-5, INSL-5 antibody
Specificity INSL5 antibody was raised against the middle region of INSL5
Cross Reactivity Human
Applications WB
Immunogen INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK
Assay Information INSL5 Blocking Peptide, catalog no. 33R-8237, is also available for use as a blocking control in assays to test for specificity of this INSL5 antibody


Western Blot analysis using INSL5 antibody (70R-3660)

INSL5 antibody (70R-3660) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of INSL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using INSL5 antibody (70R-3660) | INSL5 antibody (70R-3660) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors