Integrin alpha 3B antibody (10R-8072)

Mouse monoclonal Integrin alpha 3B antibody

Synonyms Monoclonal Integrin alpha 3B antibody, Anti-Integrin alpha 3B antibody, ITG3b antibody, ITGA3 antibody, Integrin alpha 3B
Specificity Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart
Cross Reactivity Human
Applications IHC, IHC-F, WB
Immunogen Integrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to key

Specifications

Host Mouse
Clone 54B3
Isotype IgG1
Form & Buffer Supplied in PBS containing 0.09% sodium azide

Usage & Assay Information

Usage Recommendations IHC: 1:25-1:200, WB: 1:100-1:1000

General Information

Biological Significance Cadherins constitute a family of proteins, the members of which are differentially expressed in the different tissues. One of the best characterized members is E-cadherin, which is prevalent in epithelial tissues. It has been shown to play a crucial role in the process of tumor cell metastasis. NCAM’s (neural cell adhesion molecules) exist in at least three forms of plasma membrane plycoproteins, which are expressed in a variety of tissues including most nerve cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $345.00
Size: 100 ug
OR
Shipping
View Our Distributors