Integrin Alpha 8 antibody (70R-6849)

Rabbit polyclonal Integrin Alpha 8 antibody raised against the N terminal of ITGA8

Synonyms Polyclonal Integrin Alpha 8 antibody, Anti-Integrin Alpha 8 antibody, ITGA8 antibody
Specificity Integrin Alpha 8 antibody was raised against the N terminal of ITGA8
Cross Reactivity Human
Applications WB
Immunogen Integrin Alpha 8 antibody was raised using the N terminal of ITGA8 corresponding to a region with amino acids GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
Assay Information Integrin Alpha 8 Blocking Peptide, catalog no. 33R-3233, is also available for use as a blocking control in assays to test for specificity of this Integrin Alpha 8 antibody

Images

Western Blot analysis using Integrin Alpha 8 antibody (70R-6849)

Integrin Alpha 8 antibody (70R-6849) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 117 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITGA8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Integrin alpha-8/beta-1 functions in the genesis of kidney and probably of other organs by regulating the recruitment of mesenchymal cells into epithelial structures.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Integrin Alpha 8 antibody (70R-6849) | Integrin Alpha 8 antibody (70R-6849) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors