Integrin Beta 5 antibody (70R-6842)

Rabbit polyclonal Integrin Beta 5 antibody raised against the middle region of ITGB5

Synonyms Polyclonal Integrin Beta 5 antibody, Anti-Integrin Beta 5 antibody, ITGB5 antibody, FLJ26658 antibody
Specificity Integrin Beta 5 antibody was raised against the middle region of ITGB5
Cross Reactivity Human
Applications WB
Immunogen Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFAL
Assay Information Integrin Beta 5 Blocking Peptide, catalog no. 33R-4936, is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 5 antibody

Images

Western Blot analysis using Integrin Beta 5 antibody (70R-6842)

Integrin Beta 5 antibody (70R-6842) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITGB5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognises the sequence R-G-D in its ligand.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Integrin Beta 5 antibody (70R-6842) | Integrin Beta 5 antibody (70R-6842) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors