IPPK antibody (70R-3497)

Rabbit polyclonal IPPK antibody raised against the middle region of IPPK

Synonyms Polyclonal IPPK antibody, Anti-IPPK antibody, INSP5K2 antibody, KIAA0699 antibody, C9orf12 antibody, Inositol 13456-Pentakisphosphate 2-Kinase antibody, FLJ13163 antibody, bA476B13.1 antibody
Specificity IPPK antibody was raised against the middle region of IPPK
Cross Reactivity Human
Applications WB
Immunogen IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK
Assay Information IPPK Blocking Peptide, catalog no. 33R-4685, is also available for use as a blocking control in assays to test for specificity of this IPPK antibody

Images

Western Blot analysis using IPPK antibody (70R-3497)

IPPK antibody (70R-3497) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IPPK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IPPK phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. It also protects cells from TNF-alpha-induced apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IPPK antibody (70R-3497) | IPPK antibody (70R-3497) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors