IQCD antibody (70R-4439)

Rabbit polyclonal IQCD antibody raised against the N terminal of IQCD

Synonyms Polyclonal IQCD antibody, Anti-IQCD antibody, Iq Motif Containing D antibody, 4933433C09Rik antibody
Specificity IQCD antibody was raised against the N terminal of IQCD
Cross Reactivity Human
Applications WB
Immunogen IQCD antibody was raised using the N terminal of IQCD corresponding to a region with amino acids ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR
Assay Information IQCD Blocking Peptide, catalog no. 33R-1322, is also available for use as a blocking control in assays to test for specificity of this IQCD antibody


Western Blot analysis using IQCD antibody (70R-4439)

IQCD antibody (70R-4439) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IQCD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IQCD contains 1 IQ domain. The function of the IQCD protein is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IQCD antibody (70R-4439) | IQCD antibody (70R-4439) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors