IQCE antibody (70R-3319)

Rabbit polyclonal IQCE antibody raised against the middle region of IQCE

Synonyms Polyclonal IQCE antibody, Anti-IQCE antibody, Iq Motif Containing E antibody, 1700028P05Rik antibody, KIAA1023 antibody, MGC41907 antibody
Specificity IQCE antibody was raised against the middle region of IQCE
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP
Assay Information IQCE Blocking Peptide, catalog no. 33R-4484, is also available for use as a blocking control in assays to test for specificity of this IQCE antibody


Western Blot analysis using IQCE antibody (70R-3319)

IQCE antibody (70R-3319) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IQCE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IQCE contains 2 IQ domains. The functions of IQCE remain unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IQCE antibody (70R-3319) | IQCE antibody (70R-3319) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors