IQCF1 antibody (70R-7015)

Rabbit polyclonal IQCF1 antibody raised against the middle region of IQCF1

Synonyms Polyclonal IQCF1 antibody, Anti-IQCF1 antibody, Iq Motif Containing F1 antibody, MGC39725 antibody, FLJ27508 antibody
Specificity IQCF1 antibody was raised against the middle region of IQCF1
Cross Reactivity Human
Applications WB
Immunogen IQCF1 antibody was raised using the middle region of IQCF1 corresponding to a region with amino acids ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF
Assay Information IQCF1 Blocking Peptide, catalog no. 33R-1560, is also available for use as a blocking control in assays to test for specificity of this IQCF1 antibody

Images

Western Blot analysis using IQCF1 antibody (70R-7015)

IQCF1 antibody (70R-7015) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IQCF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The exact function of IQCF1 is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IQCF1 antibody (70R-7015) | IQCF1 antibody (70R-7015) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors