ISLR2 antibody (70R-7233)

Rabbit polyclonal ISLR2 antibody raised against the N terminal of ISLR2

Synonyms Polyclonal ISLR2 antibody, Anti-ISLR2 antibody, ISLR2, ISLR-2, KIAA1465 antibody, ISLR-2 antibody, ISLR 2 antibody, ISLR 2, Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 antibody
Specificity ISLR2 antibody was raised against the N terminal of ISLR2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ISLR2 antibody was raised using the N terminal of ISLR2 corresponding to a region with amino acids PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA
Assay Information ISLR2 Blocking Peptide, catalog no. 33R-7074, is also available for use as a blocking control in assays to test for specificity of this ISLR2 antibody

Images

Western Blot analysis using ISLR2 antibody (70R-7233)

ISLR2 antibody (70R-7233) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ISLR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ISLR2 is a single-pass membrane protein. It contains 1 Ig-like (immunoglobulin-like) domain and 5 LRR (leucine-rich) repeats. The exact function of ISLR2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ISLR2 antibody (70R-7233) | ISLR2 antibody (70R-7233) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors